missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SSPN Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93891-0.02ml
This item is not returnable.
View return policy
Description
SSPN Polyclonal antibody specifically detects SSPN in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| SSPN | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| DAGA5, Kirsten-ras associated, Kirsten-ras-associated protein, KRAGNSPN, K-ras oncogene-associated protein, microspan, nanospan, sarcospan, sarcospan (Kras oncogene-associated gene), SPN1, SPN2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SSPN (NP_005077.2). MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQ | |
| 0.02 mL | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 8082 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction