missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SSC5D Polyclonal antibody specifically detects SSC5D in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | SSC5D |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | scavenger receptor cysteine rich domain containing (5 domains), scavenger receptor cysteine-rich glycoprotein, soluble scavenger protein with 5 SRCR domains, soluble scavenger receptor cysteine-rich domain-containing protein SSC5D, soluble scavenger with 5 domains |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PTPPVRVMACEPPALVELVAAVRDVGGQLQRLTQVVEQERQERQALLLGLTQLVEAARGLGQLGEAVKRLAEMAWTTSMPAPTTTTPEEEERPL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?