missing translation for 'onlineSavingsMsg'
Learn More

SS18 Antibody, Novus Biologicals™

Product Code. 18327419 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18327419 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18327419 Supplier Novus Biologicals Supplier No. H00006760B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

SS18 Polyclonal antibody specifically detects SS18 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen SS18
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot, Immunocytochemistry/ Immunofluorescence
Formulation PBS (pH 7.4)
Gene Accession No. NP_001007560.1
Gene Alias MGC116875, Protein SYT, SSXTsynovial sarcoma, translocated to X chromosome, Synovial sarcoma translocated to X chromosome protein, synovial sarcoma translocation, chromosome 18, SYTprotein SSXT
Host Species Mouse
Immunogen SS18 (NP_001007560.1, 1 a.a. - 418 a.a.) full-length human protein. MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 6760
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.