missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SRP54 Antibody, Novus Biologicals™

SRP54 Antibody, Novus Biologicals™

Product Code. 30232402 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30232402 20 μL 20µL
30228667 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30232402 Supplier Novus Biologicals Supplier No. NBP33339020ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

SRP54 Monoclonal antibody specifically detects SRP54 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen SRP54
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Monoclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS (pH 7.3), 50% glycerol, 0.05% BSA
Gene Alias signal recognition particle 54 kDa protein, signal recognition particle 54kD, signal recognition particle 54kDa
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-504 of human SRP54 (P61011).,, Sequence:, PGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM
Purification Method Affinity purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 6729
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.