missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SRGN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-80447
This item is not returnable.
View return policy
Description
SRGN Polyclonal specifically detects SRGN in Human samples. It is validated for Western Blot.
Specifications
| SRGN | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| FLJ12930, Hematopoetic proteoglycan core protein, MGC9289, P.PG, Platelet proteoglycan core protein, platelet proteoglycan protein core, PPG, PRG1p.PG, PRGhematopoetic proteoglycan core peptide, proteoglycan 1, secretory granule, proteoglycan protein core for mast cell secretory granule, secretory granule proteoglycan 1, secretory granule proteoglycan core peptide, Secretory granule proteoglycan core protein, serglycin, serglycin proteoglycan | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 5552 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_002718 | |
| SRGN | |
| Synthetic peptide directed towards the middle region of human SRGN. Peptide sequence RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Rabbit: 86%. | |
| Human, Rat, Pig, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction