SREC-II/SCARF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-83140-25ul

Code produit. 18467610

Description

SREC-II/SCARF2 Polyclonal specifically detects SREC-II/SCARF2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Spécification

• Antigen: SREC-II/SCARF2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: HUMZD58C02, scavenger receptor class F, member 2, Scavenger receptor expressed by endothelial cells 2 protein, SREC2NSR1, SREC-IIscavenger receptor class F member 2, SRECRP-1, SREPCR
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 91179
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SCARF2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:HHDLDNTLNCSFLEPPSGLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAPAESRDPEVPTVP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human SREC-II/SCARF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only