missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SREC-I/SCARF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £484.00
Specifications
| Antigen | SREC-I/SCARF1 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18244472
|
Novus Biologicals
NBP2-57396 |
100 μL |
£484.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18605606
|
Novus Biologicals
NBP2-57396-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SREC-I/SCARF1 Polyclonal specifically detects SREC-I/SCARF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SREC-I/SCARF1 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 8578 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Unconjugated | |
| RUO | |
| Human | |
| Acetyl LDL receptor, KIAA0149endothelial cells scavenger receptor, MGC47738, scavenger receptor class F, member 1, Scavenger receptor expressed by endothelial cells 1, SREC1, SREC-I, SRECscavenger receptor expressed by endothelial cells | |
| SCARF1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title