SREBP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-76535-25ul

Product Code. 18676860

Description

SREBP1 Polyclonal specifically detects SREBP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SREBP1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: BHLHD1, Class D basic helix-loop-helix protein 1, SREBP 1c, SREBP-1, SREBP1bHLHd1SREBP-1c, sterol regulatory element binding protein-1, sterol regulatory element binding transcription factor 1, sterol regulatory element-binding protein 1, Sterol regulatory element-binding transcription factor 1
• Host Species: Rabbit
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
• Gene Symbols: SREBF1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSM
• Regulatory Status: RUO
• Gene ID (Entrez): 6720
• Target Species: Human
• Form: Purified