missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SREB3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | SREB3 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Applications | Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18405001
|
Novus Biologicals
NBP1-87002 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18474381
|
Novus Biologicals
NBP1-87002-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SREB3 Polyclonal antibody specifically detects SREB3 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceEspecificaciones
| SREB3 | |
| Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| GPCR | |
| PBS (pH 7.2) and 40% Glycerol | |
| 54328 | |
| IgG | |
| Immunogen affinity purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| G protein coupled receptor 173, G protein-coupled receptor 173, G-protein coupled receptor 173, probable G-protein coupled receptor 173, SREB3Super conserved receptor expressed in brain 3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KPVQMVPAISQNWTFHGPGATGQAAANWIAGFGRGPMPPTLLGIRQNGHAASRRLLGMDEVKGEKQLGRMFY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto