missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SRCRB4D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | SRCRB4D |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18100909
|
Novus Biologicals
NBP2-37994 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18625375
|
Novus Biologicals
NBP2-37994-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SRCRB4D Polyclonal specifically detects SRCRB4D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SRCRB4D | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| S4D-SRCRB, S4-SRCRB, scavenger receptor cysteine rich domain containing, group B (4 domains), scavenger receptor cysteine-rich domain-containing group B protein, scavenger receptor cysteine-rich protein SRCRB-S4D, SRCRB-S4D, SSC4D | |
| SSC4D | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8WTU2 | |
| 136853 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title