SR140 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-70714

Product Code. 18221894

Description

SR140 Polyclonal specifically detects SR140 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SR140
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: U2SURP
• Immunogen: Synthetic peptides corresponding to SR140(U2-associated SR140 protein) The peptide sequence was selected from the middle region of SR140. Peptide sequence KVAPSKWEAVDESELEAQAVTTSKWELFDQHEESEEEENQNQEEESEDEE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: 140 kDa Ser/Arg-rich domain protein, fSAPa, KIAA0332, SR140, U2 snRNP-associated SURP domain containing, U2 snRNP-associated SURP motif-containing protein, U2-associated protein SR140
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23350
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only