missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SR140 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | SR140 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18221103
|
Novus Biologicals
NBP2-58175 |
100 μL |
£470.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18602649
|
Novus Biologicals
NBP2-58175-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SR140 Polyclonal specifically detects SR140 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SR140 | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| 140 kDa Ser/Arg-rich domain protein, fSAPa, KIAA0332, SR140, U2 snRNP-associated SURP domain containing, U2 snRNP-associated SURP motif-containing protein, U2-associated protein SR140 | |
| U2SURP | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 23350 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MVFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title