missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPTSSB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£392.00
Specifications
| Antigen | SPTSSB |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18287604
|
Novus Biologicals
NBP2-55749 |
100 μL | |||||||
Description
SPTSSB Polyclonal specifically detects SPTSSB in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SPTSSB | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ADMPsmall subunit of serine palmitoyltransferase B, chromosome 3 open reading frame 57, likely ortholog of androgen down regulated gene expressed in mouse prostate, MGC104229, Protein ADMP, ssSPTb | |
| SPTSSB | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 165679 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WAHTSSPGTILSSISLGESTFLTINLLATAGKVAGCEWGGEGRFTRSEAPKLAASAKRLCFLRFLTNKWGGM | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title