SPTLC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-54899

Product Code. 18212180

Description

SPTLC3 Polyclonal specifically detects SPTLC3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SPTLC3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: 40% glycerol and PBS (pH 7.2) with 0.02% Sodium Azide
• Gene Symbols: SPTLC3
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEA
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Concentration: 0.1 mg/mL
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence
• Gene Alias: C20orf38, Chromosome 20 Open Reading Frame 38, dJ718P11, EC 2.3.1.50, hLCB2b, LCB 3, LCB2B, LCB3, Long Chain Base Biosynthesis Protein 2b, Long Chain Base Biosynthesis Protein 3, Serine Palmitoyltransferase 3, Serine Palmitoyltransferase, Long Chain Base Subunit 2-Like (Aminotransferase 2), Serine Palmitoyltransferase, Long Chain Base Subunit 3, Serine-Palmitoyl-CoA Transferase 3, SPT 3, SPT3, SPTLC2L
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55304
• Target Species: Human
• Isotype: IgG

For Research Use Only