missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPRYD3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£410.00
Specifications
| Antigen | SPRYD3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SPRYD3 Polyclonal specifically detects SPRYD3 in Human samples. It is validated for Western Blot.Specifications
| SPRYD3 | |
| Polyclonal | |
| Rabbit | |
| Q8NCJ5 | |
| 84926 | |
| Synthetic peptides corresponding to the N terminal of SPRYD3. Immunizing peptide sequence LVPQYYSLDHQPGWLPDSVAYHADDGKLYNGRAKGRQFGSKCNSGDRIGC. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ14800, SPRY domain containing 3, SPRY domain-containing protein 3 | |
| SPRYD3 | |
| IgG | |
| 50 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title