missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPRY2 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33538-20ul
This item is not returnable.
View return policy
Description
SPRY2 Monoclonal antibody specifically detects SPRY2 in Human,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| SPRY2 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| hSPRY2, MGC23039, protein sprouty homolog 2, sprouty (Drosophila) homolog 2, sprouty 2, sprouty homolog 2 (Drosophila), spry-2 | |
| A synthetic peptide corresponding to a sequence within amino acids 216-315 of human SPRY2 (O43597).,, Sequence:, GTCVCCVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT | |
| 20 μL | |
| Growth and Development, Neuronal Cell Markers, Signal Transduction | |
| 10253 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction