missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPRR3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SPRR3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SPRR3 Polyclonal specifically detects SPRR3 in Human samples. It is validated for Western Blot.Specifications
| SPRR3 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| 22 kDa pancornulin, Cornifin beta, Esophagin, small proline-rich protein 3, SPRC | |
| SPRR3 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UBC9 | |
| 6707 | |
| Synthetic peptides corresponding to SPRR3(small proline-rich protein 3) The peptide sequence was selected from the middle region of SPRR3. Peptide sequence DQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title