missing translation for 'onlineSavingsMsg'
Learn More

SPPL2a Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

£328.00 - £470.00

Specifications

Antigen	SPPL2a
Dilution	Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18425891 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-87512-25ul	25 μL	£328.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18245937 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-87512	0.1 mL	£470.00 0.10mL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

SPPL2a Polyclonal specifically detects SPPL2a in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	SPPL2a
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	84888
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLE
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Dilution	Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	EC 3.4.23, EC 3.4.23.-, IMP-3, IMP3intramembrane cleaving protease, Intramembrane protease 3, Presenilin-like protein 2, PSL2, signal peptide peptidase-like 2A, SPPL2a, SPP-like 2A
Gene Symbols	SPPL2A
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

SPPL2a Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents