SPO11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58172

Product Code. 18738093

Description

SPO11 Polyclonal specifically detects SPO11 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: SPO11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cancer/testis antigen 35, CT35MGC39953, meiotic recombination protein SPO11, SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae), SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae), SPO11, meiotic protein covalently bound to DSB (S. cerevisiae)-like
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Pig: 100%; Equine: 92%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Chicken: 84%; Zebrafish: 76%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y5K1
• Gene Symbols: SPO11
• Immunogen: Synthetic peptides corresponding to SPO11(SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of SPO11. Peptide sequence KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISC The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: DNA Repair, Editing and Processing Endonucleases
• Gene ID (Entrez): 23626
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only