missing translation for 'onlineSavingsMsg'
Learn More

SPO11 Antibody, Novus Biologicals™

Product Code. 18373299 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18373299 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18373299 Supplier Novus Biologicals Supplier No. H00023626D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SPO11 Polyclonal antibody specifically detects SPO11 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen SPO11
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_937998.1
Gene Alias Cancer/testis antigen 35, CT35MGC39953, meiotic recombination protein SPO11, SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae), SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae), SPO11, meiotic protein covalently bound to DSB (S. cerevisiae)-like
Host Species Rabbit
Immunogen SPO11 (NP_937998.1, 1 a.a. - 358 a.a.) full-length human protein. MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASRFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADPHGIEIMCIYKYGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline DNA Repair, Editing and Processing Endonucleases
Primary or Secondary Primary
Gene ID (Entrez) 23626
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.