missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18336889

SPINK1 Antibody (4D4), Novus Biologicals™

Product Code. 18336889 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18336889 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18336889 Supplier Novus Biologicals Supplier No. H00006690M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

SPINK1 Monoclonal antibody specifically detects SPINK1 in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
TRUSTED_SUSTAINABILITY

Specifications

Antigen SPINK1
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Classification Monoclonal
Clone 4D4
Conjugate Unconjugated
Formulation PBS, pH 7.4
Gene Accession No. AAH25790
Gene Alias pancreatic secretory trypsin inhibitor, PCTTSpink3, PSTISerine protease inhibitor Kazal-type 1, serine peptidase inhibitor, Kazal type 1, serine protease inhibitor, Kazal type 1, TATITumor-associated trypsin inhibitor
Host Species Mouse
Immunogen SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 6690
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.