missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPINK1 Antibody (4D4), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00006690-M01
This item is not returnable.
View return policy
Description
SPINK1 Monoclonal antibody specifically detects SPINK1 in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Specifications
| SPINK1 | |
| Monoclonal | |
| Unconjugated | |
| AAH25790 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
| Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
| 4D4 | |
| PBS, pH 7.4 | |
| pancreatic secretory trypsin inhibitor, PCTTSpink3, PSTISerine protease inhibitor Kazal-type 1, serine peptidase inhibitor, Kazal type 1, serine protease inhibitor, Kazal type 1, TATITumor-associated trypsin inhibitor | |
| SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC | |
| 0.1 mg | |
| Cancer | |
| 6690 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction