missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPIN2A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | SPIN2A |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18293352
|
Novus Biologicals
NBP2-55824 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18675626
|
Novus Biologicals
NBP2-55824-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SPIN2A Polyclonal specifically detects SPIN2A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SPIN2A | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 54466 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| centromeric spin2 copy, DXF34dJ323P24.1, MGC88670, Protein DXF34, RP3-323P24.2, SPIN2, SPIN-2, SPIN-2A, spindlin family, member 2, spindlin family, member 2A, spindlin homolog 2, spindlin-2A, spindlin-like protein 2, Spindlin-like protein 2A | |
| SPIN2A | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title