missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Spike RBD Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33355-100ul
This item is not returnable.
View return policy
Description
Spike RBD Monoclonal antibody specifically detects Spike RBD in SARS-CoV samples. It is validated for ELISA,Western Blot
Specifications
| Spike RBD | |
| Monoclonal | |
| Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| SARS-CoV | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| A synthetic peptide corresponding to a sequence within amino acids 350-450 of coronavirus SARS-CoV Spike RBD (NP_828851.1).,, Sequence:, ADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRP | |
| 100 μL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction