missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Sperm Flagellar 2 Monoclonal antibody specifically detects Sperm Flagellar 2 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | Sperm Flagellar 2 |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence |
| Classification | Monoclonal |
| Clone | 4B10 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Alias | cancer/testis antigen 122, CT122, FLJ23164, FLJ23577, FLJ25395, KIAA1770, KPL2MGC102842, Protein KPL2, sperm flagellar 2, sperm flagellar protein 2 |
| Host Species | Mouse |
| Immunogen | FLJ23577 (NP_079143, 324 a.a. ∽ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARY |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?