Speedy/Ringo Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49476

Product Code. 18662887

Beskrivelse

Speedy/Ringo Polyclonal antibody specifically detects Speedy/Ringo in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Tekniske data

• Antigen: Speedy/Ringo
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: hSpy/Ringo A, MGC110856, Rapid inducer of G2/M progression in oocytes A, RINGO A, Ringo3, SPDY1, speedy homolog 1 (Drosophila), speedy homolog A (Xenopus laevis), speedy protein A, speedy-1, Spy1, SPY1MGC57218
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSS
• Quantity: 0.1 mL
• Research Discipline: Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair
• Gene ID (Entrez): 245711
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified