Spectrin beta 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-48703

Product Code. 18625266

Description

Spectrin beta 3 Polyclonal antibody specifically detects Spectrin beta 3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Spectrin beta 3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: Beta-III spectrin, glutamate transporter EAAT4-associated protein 41, GTRAP41, KIAA0302, SCA5, spectrin beta chain, brain 2, spectrin, beta, non-erythrocytic 2, Spectrin, non-erythroid beta chain 2, spinocerebellar ataxia 5
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PPPSTQAPSVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQSRSTESAH
• Quantity: 0.1 mL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 6712
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified