missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPECC1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£330.00 - £484.00
Specifications
| Antigen | SPECC1L |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18693977
|
Novus Biologicals
NBP2-49640-25ul |
25 μL |
£330.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18689656
|
Novus Biologicals
NBP2-49640 |
0.1 mL |
£484.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SPECC1L Polyclonal antibody specifically detects SPECC1L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| SPECC1L | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cell Biology, Cell Cycle and Replication, Immunology | |
| PBS (pH 7.2), 40% Glycerol | |
| 23384 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Cytokinesis And Spindle Organization A, Cytospin A, CYTSA, GBBB2, KIAA0376, OBLFC1, Renal Carcinoma Antigen NY-REN-22, SPECC1-Like, SPECC1-Like Protein, Sperm Antigen With Calponin Homology And Coiled-Coil Domains 1-Like | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QRHSISGPISTSKPLTALSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKT | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title