SPC25 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Marca:  Novus Biologicals NBP2-47263-25ul

Codice prodotto. 18616115

Descrizione

SPC25 Polyclonal specifically detects SPC25 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifica

• Antigen: SPC25
• Classification: Polyclonal
• Concentration: 1 mg/mL
• Dilution: Western Blot 1:250 - 1:500, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: AD024, hSpc25, kinetochore protein Spc25, MGC22228,2600017H08Rik, SPBC25, SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae), spindle pole body component 25 homolog, spindle pole body component 25 homolog (S. cerevisiae)
• Host Species: Rabbit
• Molecular Weight of Antigen: 11 kDa
• Quantity: 25 μL
• Research Discipline: Apoptosis, Biologically Active Proteins, Cytoskeleton Markers, Neuroscience, Stem Cells
• Gene ID (Entrez): 57405
• Target Species: Human, Mouse, Rat, Bovine
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), CyTOF
• Clone: S100B/1706R
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SPC25
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVY
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only