missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPATA9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SPATA9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SPATA9 Polyclonal specifically detects SPATA9 in Human samples. It is validated for Western Blot.Specifications
| SPATA9 | |
| Polyclonal | |
| Rabbit | |
| Q9BWV2 | |
| 83890 | |
| Synthetic peptides corresponding to SPATA9(spermatogenesis associated 9) The peptide sequence was selected from the N terminal of SPATA9. Peptide sequence PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ35906, NYD-SP16, spermatogenesis associated 9, spermatogenesis-associated protein 9, Testis development protein NYD-SP16 | |
| SPATA9 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title