missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ SPATA6 Recombinant Protein Antigen
Shop All Bio Techne Products
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPATA6. Source: E.coli Amino Acid Sequence: FELIQLVPPVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGNAPRLEFSTTSVITECLISSRKCHTQ The SPATA6 Recombinant Protein Antigen is derived from E. coli. The SPATA6 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications
Specifications
| Gene ID (Entrez) | 54558 |
| Purification Method | >80% by SDS-PAGE and Coomassie blue staining |
| Common Name | SPATA6 Recombinant Protein Antigen |
| Content And Storage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4. |
| For Use With (Application) | Blocking/Neutralizing, Control |
| Gene Alias | HASH, spermatogenesis associated 6 |
| Gene Symbol | SPATA6 |
| Label Type | Unlabeled |
| Product Type | Recombinant Protein Antigen |
| Show More |
For Research Use Only.
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction