missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18225677

Novus Biologicals™ SPAM1 Synthetic Peptide

Product Code. 18225677 Shop All Bio Techne Products
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
This item is not returnable. View return policy

Product Code. 18225677

Brand: Novus Biologicals™ NBP283580PEP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

55kDa synthetic peptide

located within the following region: QQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFP (Uniprot: P38567)
TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 6677
Purity Multi-step
Concentration LYOPH
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application) This peptide is useful as a blocking peptide for NBP2-83580. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochemistry under proper experimental settings.
Gene Alias EC 3.2.1.35, HYA1, HYAL1, HYAL3, HYAL5, Hyal-PH20, hyaluronidase PH-20, Hyaluronoglucosaminidase PH-20, MGC26532, PH20, PH-20, SPAG15, Sperm adhesion molecule 1, sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding), Sperm surface protein PH-20
Gene Symbol SPAM1
Molecular Weight (g/mol) M.W. Theoretical: 55 kDa
Quantity 100 μg
Research Category Cancer, Cell Biology, Cytoskeleton Markers, Signal Transduction
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.