missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPAG9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£231.00 - £484.00
Specifications
| Antigen | SPAG9 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18432302
|
Novus Biologicals
NBP1-85393-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18253646
|
Novus Biologicals
NBP1-85393 |
0.1 mL |
£484.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SPAG9 Polyclonal specifically detects SPAG9 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SPAG9 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Cancer/testis antigen 89, c-Jun NH2-terminal kinase-associated leucine zipper protein, C-Jun-amino-terminal kinase-interacting protein 4, CT89JIP4, FLJ14006, FLJ26141, FLJ34602, HLC4, HLC-6, HSS, Human lung cancer oncogene 6 protein, JLPPHETSYD1FLJ13450, JNK interacting protein, JNK/SAPK-associated protein, JNK-associated leucine-zipper protein, JNK-interacting protein 4, KIAA0516JIP-4, lung cancer oncogene 4, MAPK8IP4, Max-binding protein, MGC117291, MGC14967, MGC74461, Mitogen-activated protein kinase 8-interacting protein 4, PIG6, proliferation-inducing gene 6, Proliferation-inducing protein 6, Protein highly expressed in testis, sperm associated antigen 9, Sperm surface protein, Sperm-associated antigen 9, Sperm-specific protein, Sunday driver 1 | |
| SPAG9 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9043 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVYTEHVFTDPLGVQIPEDLSPVYQSSN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title