missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SP100 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

SP100 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Product Code. 18352665 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18352665 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18352665 Supplier Novus Biologicals Supplier No. NBP310281100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beskrivning

Rabbit Polyclonal Antibody

SP100 Polyclonal specifically detects SP100 in Mouse samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen SP100
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias DKFZp686E07254, FLJ00340, FLJ34579, lysp100b, nuclear antigen Sp100, nuclear autoantigen Sp-100, Nuclear dot-associated Sp100 protein, SP100 nuclear antigen, SP100-HMG nuclear autoantigen, Speckled 100 kDa
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse SP100 (NP_001300641.1). Peptide sequence DFEIEGNCEKAKNWRQSIRCKGWTLRELIQKGVLQDPPRKKKETPRNPRQ
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6672
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.