missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SOX5 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33400-100ul
This item is not returnable.
View return policy
Description
SOX5 Monoclonal antibody specifically detects SOX5 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| SOX5 | |
| Monoclonal | |
| Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL | |
| L-SOX5, MGC35153, SRY (sex determining region Y)-box 5, transcription factor SOX-5 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOX5 (NP_008871.3).,, Sequence:, MLTDPDLPQEFERMSSKRPASPYGEADGEVAMVTSRQKVEEEESDGLPAFHLPLHVSFPNKPHSEEFQPVSLLTQETCGHRTPTSQHNTMEVDGNKVMSS | |
| 100 μL | |
| Primary | |
| Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6660 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction