SOX17 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49549

Product Code. 18684777

Description

SOX17 Polyclonal antibody specifically detects SOX17 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SOX17
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: FLJ22252, SRY (sex determining region Y)-box 17, SRY-related HMG-box transcription factor SOX17, transcription factor SOX-17, VUR3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGE
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64321
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG