missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SORBS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-09446-100UL
This item is not returnable.
View return policy
Description
SORBS1 Polyclonal specifically detects SORBS1 in Human samples. It is validated for Western Blot.
Specifications
| SORBS1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| c-Cbl associated protein, c-Cbl-associated protein, DKFZp451C066, DKFZp586P1422, Fas-ligand associated factor 2, FLAF2, KIAA0894, KIAA1296CAPSH3D5SH3P12FLJ12406, ponsin, R85FL, SH3 domain protein 5, SH3-domain protein 5 (ponsin), sh3p12, SORB1, sorbin and SH3 domain containing 1, sorbin and SH3 domain-containing protein 1 | |
| The immunogen is a synthetic peptide directed towards the middle region of human SORBS1 (AAH42612). Peptide sequence SERRVGEQDSAPTQEKPTSPGKAIEKRAKDDSRRVVKSTQDLSDVSMDEV | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10580 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction