SON Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-95174-0.1ml

Product Code. 18649561

Description

SON Polyclonal antibody specifically detects SON in Human samples. It is validated for Western Blot

Specifications

• Antigen: SON
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: BASS1C21orf50, Bax antagonist selected in saccharomyces 1, DBP5, DBP-5, FLJ33914, KIAA1019SON3, Negative regulatory element-binding protein, NREBPNRE-binding protein, Protein DBP-5, protein SON, SON DNA binding protein, SON DNA-binding protein, KIAA101910FLJ21099
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 850-950 of human SON (NP_001278340.1). TMDSQMLATSSMDSQMLASGTMDSQMLASGTMDAQMLASGTMDAQMLASSTQDSAMLGSKSPDPYRLAQDPYRLAQDPYRLGHDPYRLGHDAYRLGQDPYR
• Quantity: 0.1 mL
• Research Discipline: Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Endocrinology
• Gene ID (Entrez): 6651
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified