missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Somatostatin Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£171.00 - £393.00
Specifications
| Antigen | Somatostatin |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18651481
|
Novus Biologicals
NBP2-93171-0.02ml |
0.02 mL |
£171.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18605520
|
Novus Biologicals
NBP2-93171-0.1ml |
0.1 mL |
£393.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Somatostatin Polyclonal antibody specifically detects Somatostatin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| Somatostatin | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Breast Cancer, Cancer, Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol | |
| 6750 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Growth hormone release-inhibiting factor, SMST, somatostatin, somatostatin-14, somatostatin-28 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human SST (NP_001039.1). TGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title