Solo Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68737

Product Code. 18619556

Description

Solo Polyclonal antibody specifically detects Solo in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: Solo
• Classification: Polyclonal
• Dilution: Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
• Gene Alias: DKFZp434O0515, Huntingtin-interacting protein-like protein, Protein Solo, SEC14 and spectrin domains 1, SEC14 domain and spectrin repeat-containing protein 1, SOLO
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHSEWFAVYVEL
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 91404
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified