missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Sodium Potassium ATPase Alpha 2 Rabbit anti-Mouse, Rat, Clone: 5T3O4, Novus Biologicals™

Sodium Potassium ATPase Alpha 2 Rabbit anti-Mouse, Rat, Clone: 5T3O4, Novus Biologicals™

Product Code. 18355322
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18355322 20 μg 20µL
18380485 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18355322 Supplier Bio-Techne Supplier No. NBP31573720UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Sodium Potassium ATPase Alpha 2 Monoclonal antibody specifically detects Sodium Potassium ATPase Alpha 2 in Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Sodium Potassium ATPase Alpha 2
Applications Western Blot
Classification Monoclonal
Clone 5T3O4
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias alpha-A(+) catalytic polypeptide, ATPase, Na+/K+ transporting, alpha 2 (+) polypeptide, ATPase, Na+/K+ transporting, alpha 2 polypeptide, EC 3.6.3, EC 3.6.3.9, KIAA0778, MGC59864, MHP2, migraine, hemiplegic 2, Na(+)/K(+) ATPase alpha-2 subunit, Na+/K+ ATPase, alpha-B polypeptide, Sodium pump subunit alpha-2, sodium/potassium-transporting ATPase alpha-2 chain, sodium/potassium-transporting ATPase subunit alpha-2, sodium-potassium ATPase
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sodium Potassium ATPase Alpha 2 (P50993). MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVLARDGPNALTPPPTTPEWVKFCRQLFGGFSI
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 477
Target Species Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.