missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNX5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17936-100UL
This item is not returnable.
View return policy
Description
SNX5 Polyclonal antibody specifically detects SNX5 in Human samples. It is validated for Western Blot, Immunofluorescence
Specifications
| SNX5 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| FLJ10931, sorting nexin 5, sorting nexin-5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MVVVPELLQQQEEDRSKLRSVSVDLNVDPSL | |
| 100 μg | |
| Core ESC Like Genes, Signal Transduction, Stem Cell Markers | |
| 27131 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction