missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SNX5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

SNX5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18312825 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Conditionnement:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity unitSize
18312825 25 μg 25µL
18332115 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18312825 Fournisseur Novus Biologicals Code fournisseur NBP31793625UL

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

SNX5 Polyclonal antibody specifically detects SNX5 in Human samples. It is validated for Western Blot, Immunofluorescence
TRUSTED_SUSTAINABILITY

Spécification

Antigen SNX5
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias FLJ10931, sorting nexin 5, sorting nexin-5
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MVVVPELLQQQEEDRSKLRSVSVDLNVDPSL
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Signal Transduction, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 27131
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.