missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNTG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SNTG1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SNTG1 Polyclonal specifically detects SNTG1 in Mouse samples. It is validated for Western Blot.Specifications
| SNTG1 | |
| Polyclonal | |
| Rabbit | |
| Q925E1 | |
| 54212 | |
| Synthetic peptides corresponding to the N terminal of Sntg1. Immunizing peptide sequence KLPVNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| G1SYNsyntrophin-4, gamma-1-syntrophin, gamma1-syntrophin, SYN4syntrophin 4, syntrophin, gamma 1, Syntrophin-4 | |
| SNTG1 | |
| IgG | |
| 57 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title