missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNRPE Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94255-0.02ml
This item is not returnable.
View return policy
Description
SNRPE Polyclonal antibody specifically detects SNRPE in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SNRPE | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| B-raf, Sm protein E, small nuclear ribonucleoprotein E, small nuclear ribonucleoprotein polypeptide E, SmE, Sm-ESME, snRNP-E | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human SNRPE (NP_003085.1). MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN | |
| 0.02 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6635 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction