missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNRPD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57174
This item is not returnable.
View return policy
Description
SNRPD2 Polyclonal specifically detects SNRPD2 in Human samples. It is validated for Western Blot.
Specifications
| SNRPD2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| SNRPD2 | |
| Synthetic peptides corresponding to SNRPD2(small nuclear ribonucleoprotein D2 polypeptide 16.5kDa) The peptide sequence was selected from the middle region of SNRPD2. Peptide sequence ENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAG. | |
| 100 μL | |
| Stem Cell Markers | |
| 6633 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| small nuclear ribonucleoprotein D2 polypeptide (16.5kD), small nuclear ribonucleoprotein D2 polypeptide 16.5kDa, small nuclear ribonucleoprotein Sm D2, Sm-D2SMD2, snRNP core protein D2, SNRPD1 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%; Human: 92%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction