missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNRPD1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£164.00 - £366.00
Specifications
| Antigen | SNRPD1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18675601
|
Novus Biologicals
NBP2-94494-0.02ml |
0.02 mL |
£164.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18665840
|
Novus Biologicals
NBP2-94494-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SNRPD1 Polyclonal antibody specifically detects SNRPD1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| SNRPD1 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Immunology | |
| PBS (pH 7.3), 50% glycerol | |
| 6632 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| HsT2456, small nuclear ribonucleoprotein D1 polypeptide 16kDa, small nuclear ribonucleoprotein Sm D1, Sm-D autoantigen, Sm-D1, SMD1, snRNP core protein D1, SNRPD | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human SNRPD1 (NP_008869.1). MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title