missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNRPB2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | SNRPB2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18205295
|
Novus Biologicals
NBP2-58608 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18686088
|
Novus Biologicals
NBP2-58608-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SNRPB2 Polyclonal specifically detects SNRPB2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SNRPB2 | |
| Polyclonal | |
| Rabbit | |
| Immunology | |
| MGC24807, MGC45309, Msl1, small nuclear ribonucleoprotein polypeptide B, small nuclear ribonucleoprotein polypeptide B'', small nuclear ribonucleoprotein polypeptide B2, U2 small nuclear ribonucleoprotein B'', U2 snRNP B'' | |
| SNRPB2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 6629 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title