SNRPB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35914-20ul

Product Code. 30233005

Description

SNRPB Polyclonal antibody specifically detects SNRPB in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)

Specifications

• Antigen: SNRPB
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: CODB polypeptide of Sm protein, Sm protein B/B', small nuclear ribonucleoprotein polypeptides B and B', small nuclear ribonucleoprotein polypeptides B and B1, small nuclear ribonucleoprotein-associated proteins B and B', SmB/B', Sm-B/B'sm-B/Sm-B', SmB/SmB', snRNP-Bsmall nuclear ribonucleoprotein polypeptide B, SNRPB1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SNRPB (NP_003082.1).,, Sequence:, MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGA
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6628
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG