missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18345479

Novus Biologicals™ SNRPB Antibody (1B4), Novus Biologicals™

Product Code. 18345479 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18345479 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18345479 Supplier Novus Biologicals™ Supplier No. H00006628M01100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

SNRPB Monoclonal antibody specifically detects SNRPB in Human samples. It is validated for ELISA,Sandwich ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen SNRPB
Applications ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1B4
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_003082
Gene Alias CODB polypeptide of Sm protein, Sm protein B/B', small nuclear ribonucleoprotein polypeptides B and B', small nuclear ribonucleoprotein polypeptides B and B1, small nuclear ribonucleoprotein-associated proteins B and B', SmB/B', Sm-B/B'sm-B/Sm-B', SmB/SmB', snRNP-Bsmall nuclear ribonucleoprotein polypeptide B, SNRPB1
Host Species Mouse
Immunogen SNRPB (NP_003082, 1 a.a. ∽ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
Purification Method IgG purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6628
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.