SNRP70 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Brand:  Novus Biologicals NBP1-57487

Product Code. 18262365

Description

SNRP70 Polyclonal specifically detects SNRP70 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SNRP70
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: RNPU1ZU170K, RPU1U1AP, small nuclear ribonucleoprotein 70kDa (U1), Snp1, snRNP70, SNRP70U1 small nuclear ribonucleoprotein 70 kDa, U1 snRNP 70 kDa, U1-70Ksmall nuclear ribonucleoprotein 70kDa (RNP antigen), U1AP1, U1RNP
• Host Species: Rabbit
• Molecular Weight of Antigen: 51 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Human: 100%; Western clawed frog: 100%; Bovine: 100%; Zebrafish: 100%; Xenopus: 100%; Canine: 100%; Rat: 100%; African malaria mosquito: 92%; Yellowfever mosquito: 92%; Mosquito: 92%; Harpegnathos saltator: 92%; Camponotus floridanus: 92%; Brown alga: 92%; Red flour beetle: 92%; Florida lancelet: 92%; Black-legged tick: 92%; Trichoplax reptans: 92%; Fruit fly: 92%; Caenorhabditis elegans: 85%; Caenorhabditis vulgaris: 85%; Eye worm: 85%; Body louse: 85%; Caenorhabditis briggsae: 85%; Filarial nematode worm: 85%; Planarian: 85%; Starlet sea anemone: 85%; Toxoplasma gondii ME49: 84%; Toxoplasma gondii: 84%; Blood fluke: 83%; Moss: 76%; Spikemoss: 76%; Volvox carteri f. nagariensis: 76%; Chlorella variabilis: 76%; Chlamydomonas smithii: 76%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: P08621
• Gene Symbols: SNRNP70
• Immunogen: Synthetic peptides corresponding to SNRP70 (small nuclear ribonucleoprotein 70kDa polypeptide (RNP antigen)) The peptide sequence was selected from the N terminal of SNRP70 (NP_003080). Peptide sequence PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6625
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only